PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11587_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 136aa    MW: 14680.3 Da    PI: 10.7326
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11587_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.7e-383292262
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++++lkcprC+s ntkfCyynny+ sqPr+fCk+CrryWtkGG lrnvPvGgg+r  k+s+
  RrC11587_p2 32 HHQSLKCPRCNSLNTKFCYYNNYNHSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRTAKRSK 92
                 57899***************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-312388IPR003851Zinc finger, Dof-type
PfamPF027019.3E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7053690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MTGSGGGGGG STVRFLGGDR RMRVHQNNIL NHHQSLKCPR CNSLNTKFCY YNNYNHSQPR  60
HFCKSCRRYW TKGGVLRNVP VGGGCRTAKR SKSKQPPSSS PSTADKPTTA QDGEEKPSSS  120
ETSSLTASTS TAVTAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136402.13e-58PREDICTED: dof zinc finger protein DOF5.4
SwissprotQ8LDR04e-58DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLM4D9433e-58M4D943_BRARP; Uncharacterized protein
STRINGBra013003.1-P9e-58(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-49OBF binding protein 4